PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G17770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 417aa    MW: 44692.6 Da    PI: 6.7218
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G17770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1584e-49421672128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  +
  OGLUM05G17770.1  42 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGE 134
                      79***************************.89***************7777899**************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkktLvfy+g+apkg++++W+m+eyrl
  OGLUM05G17770.1 135 NSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 167
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5741190IPR003441NAC domain
PROSITE profilePS5100554.84941190IPR003441NAC domain
PfamPF023651.7E-2443167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MSRDDVDDVT AGAAGSGEEA AADQEEAAAA VAGDSHENDL VMPGFRFHPT EEELIEFYLR  60
RKVEGRRFNV ELITFLDLYR FDPWELPAMA VIGEKEWFFY VPRDRKYRNG DRPNRVTASG  120
YWKATGADRM IRGENSRPIG LKKTLVFYSG KAPKGVRSSW IMNEYRLPPP AADADLFYKS  180
EISLCRVYKR SGIDDGHGHH QRPAGNVQAS SSSAAARPPE QHSGNNTAAG LPACRHRPSP  240
SSSSTTTAQQ HTSFHQLLQG ECSSAAAAAP PPPSLPASAT TRNSNASQLL MPPPPPRPPC  300
AAAYTSAAAA PTESAAVLAA ASTYSLLAAA GSSSTHIDEL STLLAGHSHG GAYVNNHIVA  360
GSHHHFPLPP SQLMPQLGTL PISPPLAAVS DKLWDWSSVP DTSTARDYDS SGFSDPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-564319119166NO APICAL MERISTEM PROTEIN
1ut4_B8e-564319119166NO APICAL MERISTEM PROTEIN
1ut7_A8e-564319119166NO APICAL MERISTEM PROTEIN
1ut7_B8e-564319119166NO APICAL MERISTEM PROTEIN
4dul_A8e-564319119166NAC domain-containing protein 19
4dul_B8e-564319119166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637953.10.0PREDICTED: NAC domain-containing protein 48-like
TrEMBLA0A0D9ZZ990.0A0A0D9ZZ99_9ORYZ; Uncharacterized protein
STRINGORGLA05G0144900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-95NAC domain containing protein 35